A database of hormones and their receptors

Peptide Hormone

Search Result - 1

HMRbase accession number	10463
Swiss-prot Accession number	P49794 (Sequence in FASTA format)
Description	Pro-MCH precursor [Contains: Melanin-concentrating hormone (MCH)].
Source organism	Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	N/A
Developmental Stage	N/A
Similarity	Belongs to the melanin-concentrating hormone family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Plays a role in skin pigmentation by antagonizing the action of melanotropin alpha. Induces melanin concentration within the melanophores. May participate in the control of the hypothalamo-pituitary adrenal gland axis by inhibiting the release of ACTH
Protein Length	136 Amino acids
Molecular weight	15410
References	1 Groneveld D., Hut M.J., Balm P.H.M., Martens G.J.M.,Wendelaar Bonga S.E.; "Cloning and sequence analysis of hypothalamus cDNA encoding tilapiamelanin-concentrating hormone."; Fish Physiol. Biochem. 11:117-124(1993).
Domain Name	N/A
Hormone Name	Melanin-concentrating hormone
Mature Hormone Sequence	RDTMRCMVGRVYRPCWEV
Position of mature hormone in Pre-Hormone protein	18 Residues from position (119-136)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 2

HMRbase accession number	10753
Swiss-prot Accession number	P34746 (Sequence in FASTA format)
Description	Somatotropin precursor (Growth hormone).
Source organism	Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	Secreted protein
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	Growth hormone plays an important role in growth control and involved in the regulation of several anabolic processes
Protein Length	204 Amino acids
Molecular weight	23151
References	1 Chen J.-Y., Chang C.-Y., Shen S.-C., Wang J.-I., Wu J.-L.; "Production of recombinant Oreochromis mossambicus growth hormone (GH)polypeptides in E. coli cells and characterization of the molecularstructure of the GH gene."; Submitted (NOV-1997) to the EMBL/GenBank/DDBJ databases. 2 PubMed abstract 2019405
Domain Name	Hormone_1
Hormone Name	Somatotropin
Mature Hormone Sequence	QQITDSQRLFSIAVNRVTHLYLLAQRLFSDFESSLQTEEQRQLNKIFLQDFCNSDYIISPIDKHETQRSSVLKLLSISYGLVESWEFPSRSLSGGSSLRNQISPRLSELKTGILLLIRANQDEAENYPDTDTLQHAPYGNYYQSLGGNESLRQTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL
Position of mature hormone in Pre-Hormone protein	187 Residues from position (18-204)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 3

HMRbase accession number	11001
Swiss-prot Accession number	P09319 (Sequence in FASTA format)
Description	Prolactin-1 precursor (Prolactin I) (PRL-188).
Source organism	Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	212 Amino acids
Molecular weight	23530
References	1 PubMed abstract 2670495 2 PubMed abstract 1418624 3 PubMed abstract 3379064 4 PubMed abstract 3865172
Domain Name	Hormone_1
Hormone Name	Prolactin-1
Mature Hormone Sequence	VPINELFERASQHSDKLHSLSTTLTQELDSHFPPIGRVIMPRPAMCHTSSLQTPIDKDQALQVSESDLMSLARSLLQAWSDPLVVLSSSASTLPHPAQSTIFNKIQEMQQYSKSLKDGLDVLSSKMGSPAQAITSLPYRGGTNLGHDKITKLINFNFLLSCLRRDSHKIDSFLKVLRCRAAKMQPEMC
Position of mature hormone in Pre-Hormone protein	188 Residues from position (25-212)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated

Search Result - 4

HMRbase accession number	11004
Swiss-prot Accession number	P09318 (Sequence in FASTA format)
Description	Prolactin-2 precursor (Prolactin II) (PRL-177).
Source organism	Oreochromis mossambicus (Mozambique tilapia) (Tilapia mossambica)
Taxonomical Classification	Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi;Actinopterygii; Neopterygii; Teleostei; Euteleostei; Neoteleostei;Acanthomorpha; Acanthopterygii; Percomorpha; Perciformes; Labroidei;Cichlidae; African cichlids; Pseudocrenilabrinae; Tilapiini;Oreochromis.
Subcellular location	Secreted
Developmental Stage	N/A
Similarity	Belongs to the somatotropin/prolactin family.
Tissue Specificity	N/A
Post translational modification	N/A
Function	N/A
Protein Length	200 Amino acids
Molecular weight	22183
References	1 PubMed abstract 2670495 2 PubMed abstract 3379064 3 PubMed abstract 3865172
Domain Name	Hormone_1
Hormone Name	Prolactin-2
Mature Hormone Sequence	VPINDLIYRASQQSDKLHALSSMLTQELGSEAFPIDRVLACHTSSLQTPTDKEQALQVSESDLLSLARSLLQAWSDPLEVLSSSTNVLPYSAQSTLSKTIQKMQEHSKDLKDGLDILSSKMGPAAQTITSLPFIETNEIGQDKITKLLSCFRRDSHKIDSFLKVLRCRAANMQPQVC
Position of mature hormone in Pre-Hormone protein	177 Residues from position (24-200)
Receptor	N/A
Gene ID	N/A
PDB ID	N/A
Drugpedia	wiki
Comments	!Receptor for this Hormone are either unknown or have not yet been curated